PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aco013230.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Bromeliaceae; Ananas
Family TALE
Protein Properties Length: 566aa    MW: 62927.4 Da    PI: 7.5668
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aco013230.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox25.42.5e-083473841954
                  HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
     Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                  Fe   ++yp+  ++  L++++gL+ +qV++WF N R +
  Aco013230.1 347 FEHflHPYPNDVDKHILSRQTGLSRSQVSNWFINARVR 384
                  664459******************************88 PP

2BELL110.69.2e-36211279472
         BELL   4 elqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                  elqk++akL ++leeVd+rY++y+eq+++v+ssFeavag g+a++Y +lA++a+SrhFrcL+dai++qi
  Aco013230.1 211 ELQKRRAKLFTMLEEVDRRYRKYCEQMRAVVSSFEAVAGGGAAAVYSKLASRAMSRHFRCLRDAIVGQI 279
                  89******************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005748.7E-53145277IPR006563POX domain
PfamPF075267.4E-45151276IPR006563POX domain
PROSITE profilePS5007111.515325388IPR001356Homeobox domain
SMARTSM003895.6E-8328392IPR001356Homeobox domain
CDDcd000867.48E-11328388No hitNo description
SuperFamilySSF466891.24E-16329395IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.9E-27331395IPR009057Homeodomain-like
PfamPF059207.4E-17345384IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048481Biological Processplant ovule development
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0009506Cellular Componentplasmodesma
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 566 aa     Download sequence    Send to blast
MMAHESNYTD FPSNPTTMHG FDSNHDLFAI QAASGLDMVG FSSKQHQIIS SNHVRGFFPK  60
ELSNIASSVS PWPIDDTAIR HHSGGLSLSL SNPRPSSDAF GLAHDQPFNQ GDASHNHHGL  120
LSRASASASH QQQLLMHEGM RAFHSQQTFQ LGSSKYMIPA RELLNEFCSL GGDQSSLMKK  180
PQKSTSQWEE GASSSSTSWG HQSLHSLDLL ELQKRRAKLF TMLEEVDRRY RKYCEQMRAV  240
VSSFEAVAGG GAAAVYSKLA SRAMSRHFRC LRDAIVGQIR ATKKAMGEKE PVAPGMTRGE  300
TPRLKILDQC LRQQKAFQQG SFMETHPWRP QRGLPERSVS ILRAWLFEHF LHPYPNDVDK  360
HILSRQTGLS RSQVSNWFIN ARVRLWKPMV EEMYMEEMKE QEKQSSNLAT GHQDTTTNQN  420
PNPKPHPGLD QKPPPGRHLI PNSDSLSSVV NGGHSRDQGE NATMKSARHH DIAANFGMED  480
WDFPSYNNGG HNLGSSVSLT LGLQQHNGGG MSLSFAPPPE QSTLLFARDH IDDNQPVHFS  540
MLDGEAQALP YRDLMGAQLL HDMAG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_B7e-15334392563Homeobox protein Meis2
3k2a_A7e-15334392563Homeobox protein Meis2
4xrm_B7e-15334392563Homeobox protein Meis2
4xrm_A7e-15334392563Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKM6641941e-163KM664194.1 Ananas bracteatus clone 48972c microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010934930.10.0PREDICTED: homeobox protein BEL1 homolog
SwissprotQ388971e-125BEL1_ARATH; Homeobox protein BEL1 homolog
TrEMBLM0S5220.0M0S522_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr2P04310_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP63983547
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G41410.11e-114TALE family protein